Sermorelin Acetate
Sermorelin Acetate
Sermorelin Acetate
  1. Sermorelin Acetate
  2. Sermorelin Acetate
  3. Sermorelin Acetate

Sermorelin Acetate

Price range: £46.00 through £64.00

Lyophilised research peptide | Endocrinology research

Sermorelin Acetate is a synthetic peptide fragment supplied as a lyophilised solid, intended exclusively for laboratory research applications. It is commonly used in endocrinology-focused studies and related experimental models where precision, stability, and reproducibility are essential.

This product is manufactured and tested to meet high analytical standards, with purity typically ≥98%, verified using HPLC methodology. It is not approved for human or veterinary use.

SKU: N/A Category:

Chemical & physical information

Peptide sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 (acetate salt)
Molecular formula: C149H246N44O42S
Molecular weight: ~3358 g/mol
Form: Lyophilised powder

Research context

Sermorelin is widely studied as part of growth hormone-related signalling research, particularly in experimental settings examining:

  • Pituitary hormone release mechanisms
  • Endocrine feedback loops
  • Cellular growth and regeneration pathways
  • Metabolic regulation models

Due to its defined structure and stability, Sermorelin Acetate is frequently used in controlled laboratory studies investigating growth-related biochemical processes and cellular signalling dynamics.

Quality & handling

  • Supplied as a lyophilised solid for laboratory preparation
  • Analytical purity verified by HPLC
  • Batch-specific documentation available

For research use only
Sermorelin Acetate is typically chosen by research groups requiring a well-characterised peptide with consistent analytical performance across experimental batches.

Specification

10mg × 10 vials, 10mg × 20 vials

Reviews

There are no reviews yet.

Be the first to review “Sermorelin Acetate”

Your email address will not be published. Required fields are marked *

Related products