Chemical & physical information
Peptide sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 (acetate salt)
Molecular formula: C149H246N44O42S
Molecular weight: ~3358 g/mol
Form: Lyophilised powder
Research context
Sermorelin is widely studied as part of growth hormone-related signalling research, particularly in experimental settings examining:
- Pituitary hormone release mechanisms
- Endocrine feedback loops
- Cellular growth and regeneration pathways
- Metabolic regulation models
Due to its defined structure and stability, Sermorelin Acetate is frequently used in controlled laboratory studies investigating growth-related biochemical processes and cellular signalling dynamics.
Quality & handling
- Supplied as a lyophilised solid for laboratory preparation
- Analytical purity verified by HPLC
- Batch-specific documentation available
For research use only
Sermorelin Acetate is typically chosen by research groups requiring a well-characterised peptide with consistent analytical performance across experimental batches.






Reviews
There are no reviews yet.