TB-500 (Thymosin Beta-4)
TB-500 (Thymosin Beta-4)
TB-500 (Thymosin Beta-4)
  1. TB-500 (Thymosin Beta-4)
  2. TB-500 (Thymosin Beta-4)
  3. TB-500 (Thymosin Beta-4)

TB-500 (Thymosin Beta-4)

£49.00

Lyophilised research peptide | Cellular regeneration research

TB-500 is provided as a high-purity, lyophilised research peptide, intended solely for laboratory research use. It is commonly handled in controlled experimental settings for cellular and tissue- level investigation and is not authorised for human or veterinary application.

This peptide is analytically characterised to meet high laboratory standards, with purity typically ≥98%, verified using established analytical techniques such as HPLC.

Specification: 10mg × 10 vials

Category:

Chemical & physical information

Molecular formula: C212H350N56O78S
Molecular weight: ~4963.4 g/mol
Amino acid sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Form: Lyophilised solid

Research context

TB-500 is a synthetic peptide related to thymosin beta-4 and is widely explored in cellular regeneration and tissue-repair research models. Its structure has made it of interest in studies examining:

  • Cell migration and differentiation
  • Tissue repair and wound-healing models
  • Inflammatory pathway modulation
  • Angiogenesis and vascular response research

Due to its larger molecular structure and stability, TB-500 is frequently selected for advanced regenerative medicine research and cell-signalling investigations in laboratory environments.

Quality & handling

  • Supplied as a lyophilised powder for laboratory use
  • Purity verified by chromatographic analysis
  • Batch-specific analytical documentation available

For research use only

Reviews

There are no reviews yet.

Be the first to review “TB-500 (Thymosin Beta-4)”

Your email address will not be published. Required fields are marked *

Related products