Description
About Tesamorelin
Tesamorelin is a synthetic analogue of human growth hormone-releasing hormone (GHRH), also known as growth hormone-releasing factor (GRF). It retains the 44-amino-acid GHRH sequence while incorporating an N-terminal trans-3-hexenoyl modification.
GHRH acts through the growth hormone-releasing hormone receptor (GHRH-R), a G-protein-coupled receptor strongly associated with pituitary somatotroph cells and the regulation of endogenous growth-hormone synthesis and release.
Tesamorelin therefore provides a defined research compound for investigating GHRH-receptor activation, somatotropic signalling, growth-hormone regulation and downstream GH/IGF-1 biology.
Its research literature also extends into metabolic physiology, providing a useful experimental framework for studying relationships between the somatotropic axis, adipose-tissue biology and wider metabolic signalling.
Pronoia Bio supplies Tesamorelin – 10mg as a batch-tested research material with a minimum purity standard of ≥99%.
Product Specification
Product: Tesamorelin
Strength: 10mg
SKU: PB-TESA-10
Peptide class: Synthetic modified GHRH analogue
Peptide length: 44 amino acids
Structural feature: N-terminal trans-3-hexenoyl modification
Peptide backbone sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Primary research target: Growth hormone-releasing hormone receptor (GHRH-R)
Research focus: GHRH signalling, growth-hormone regulation, GH/IGF-1 biology and metabolic signalling
Purity: ≥99%
Form: Lyophilised solid
Documentation: Batch-specific COA & SDS available
Exact chemical form and other batch-dependent analytical characteristics should be confirmed against the current Certificate of Analysis.
Testing & Batch Documentation
Tesamorelin – 10mg is supplied as batch-tested research material against Pronoia Bio’s minimum ≥99% purity standard.
Each batch is managed separately to maintain traceability between supplied material, Pronoia inventory and supporting documentation.
Batch-specific analytical information is provided through the relevant Certificate of Analysis, with the current COA treated as the authoritative reference for purity, supplied chemical form and other batch-dependent characteristics.
Supporting Safety Data Sheet documentation is also available for laboratory reference.
Research Context
GHRH-receptor signalling
Tesamorelin is structurally derived from human GHRH and retains activity at the growth hormone-releasing hormone receptor. GHRH-R is principally associated with pituitary somatotroph signalling and participates in the regulation of growth-hormone synthesis and release.
Receptor activation is associated with intracellular signalling involving cyclic AMP and downstream processes regulating somatotropic activity.
Growth-hormone & GH/IGF-1 biology
GHRH forms part of the physiological regulatory network controlling pulsatile growth-hormone release. Growth hormone subsequently interacts with the wider GH/IGF-1 axis alongside regulatory feedback involving IGF-1 and somatostatin.
Tesamorelin therefore provides a research model for studying both receptor-level GHRH signalling and downstream endocrine regulation within the somatotropic axis.
Structural modification
Tesamorelin incorporates an N-terminal trans-3-hexenoyl modification while retaining the 44-amino-acid GHRH peptide backbone.
This structural distinction makes it useful in comparative studies examining modified GHRH analogues, peptide stability and structure–activity relationships within GHRH-receptor research.
Metabolic research
Tesamorelin has also been investigated within metabolic research, including studies examining relationships between GHRH/GH signalling, lipid metabolism and adipose-tissue distribution.
These findings provide research context for studying how somatotropic signalling intersects with metabolic physiology and should not be interpreted as establishing equivalent effects for Pronoia research material.
Storage & Handling
Store the lyophilised material under controlled conditions appropriate to the current batch documentation and protect from unnecessary heat, light and moisture.
Laboratories should minimise repeated temperature changes and maintain appropriate sample identification and inventory controls during storage and handling.
The current COA and SDS should take precedence for batch-specific storage and handling requirements.
UK Delivery
Tesamorelin – 10mg is supplied by Pronoia Bio within the United Kingdom using tracked delivery services.
Current availability, dispatch information and available delivery services are shown on the website and during checkout.
Research Use
Tesamorelin – 10mg is supplied exclusively for laboratory, analytical and experimental research.
It is not for human or veterinary use and is not intended for consumption, therapeutic application, diagnosis, treatment or administration.
Pronoia Bio does not provide dosage, administration or clinical-use guidance.
